![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.257: SipA N-terminal domain-like [140745] (1 superfamily) multihelical; bundle; the last helix is buried inside the bundle |
![]() | Superfamily a.257.1: SipA N-terminal domain-like [140746] (1 family) ![]() automatically mapped to Pfam PF09052 |
![]() | Family a.257.1.1: SipA N-terminal domain-like [140747] (1 protein) N-terminal part of Pfam PF09052 |
![]() | Protein Cell invasion protein SipA, N-terminal domain [140748] (1 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [140749] (2 PDB entries) Uniprot Q56027 23-262! Uniprot Q56027 49-263 |
![]() | Domain d2fm8c1: 2fm8 C:23-262 [133769] Other proteins in same PDB: d2fm8a1, d2fm8b2, d2fm8b3 |
PDB Entry: 2fm8 (more details), 2.2 Å
SCOPe Domain Sequences for d2fm8c1:
Sequence, based on SEQRES records: (download)
>d2fm8c1 a.257.1.1 (C:23-262) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} qatnlaanlsavresatatlsgeikgpqledfpalikqasldalfkcgkdaealkevftn snnvagkkaimefaglfrsalnatsdspeaktllmkvgaeytaqiikdglkeksafgpwl petkkaeaklenlekqlldiiknntggelsklstnlvmqevmpyiasciehnfgctldpl trsnlthlvdkaaakavealdmchqkltqeqgtsvgrearhlemqtliplllrnvfaqip
>d2fm8c1 a.257.1.1 (C:23-262) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]} qatnlaanlsavresatatlsgedfpalikqasldalfkcgkdaealkevftnsnnvagk kaimefaglfrsalnatsdspeaktllmkvgaeytaqiikdglkeksafgpwlpetkkae aklenlekqlldiiknnelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvd kaaakavealdmchqklearhlemqtliplllrnvfaqip
Timeline for d2fm8c1: