Lineage for d2fm8c1 (2fm8 C:23-262)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2020404Fold a.257: SipA N-terminal domain-like [140745] (1 superfamily)
    multihelical; bundle; the last helix is buried inside the bundle
  4. 2020405Superfamily a.257.1: SipA N-terminal domain-like [140746] (1 family) (S)
    automatically mapped to Pfam PF09052
  5. 2020406Family a.257.1.1: SipA N-terminal domain-like [140747] (1 protein)
    N-terminal part of Pfam PF09052
  6. 2020407Protein Cell invasion protein SipA, N-terminal domain [140748] (1 species)
  7. 2020408Species Salmonella typhimurium [TaxId:90371] [140749] (2 PDB entries)
    Uniprot Q56027 23-262! Uniprot Q56027 49-263
  8. 2020410Domain d2fm8c1: 2fm8 C:23-262 [133769]
    Other proteins in same PDB: d2fm8a1, d2fm8b2, d2fm8b3

Details for d2fm8c1

PDB Entry: 2fm8 (more details), 2.2 Å

PDB Description: crystal structure of the salmonella secretion chaperone invb in complex with sipa
PDB Compounds: (C:) Cell invasion protein sipA

SCOPe Domain Sequences for d2fm8c1:

Sequence, based on SEQRES records: (download)

>d2fm8c1 a.257.1.1 (C:23-262) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
qatnlaanlsavresatatlsgeikgpqledfpalikqasldalfkcgkdaealkevftn
snnvagkkaimefaglfrsalnatsdspeaktllmkvgaeytaqiikdglkeksafgpwl
petkkaeaklenlekqlldiiknntggelsklstnlvmqevmpyiasciehnfgctldpl
trsnlthlvdkaaakavealdmchqkltqeqgtsvgrearhlemqtliplllrnvfaqip

Sequence, based on observed residues (ATOM records): (download)

>d2fm8c1 a.257.1.1 (C:23-262) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
qatnlaanlsavresatatlsgedfpalikqasldalfkcgkdaealkevftnsnnvagk
kaimefaglfrsalnatsdspeaktllmkvgaeytaqiikdglkeksafgpwlpetkkae
aklenlekqlldiiknnelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvd
kaaakavealdmchqklearhlemqtliplllrnvfaqip

SCOPe Domain Coordinates for d2fm8c1:

Click to download the PDB-style file with coordinates for d2fm8c1.
(The format of our PDB-style files is described here.)

Timeline for d2fm8c1: