SCOPe 2.05: Domain d2fm8c1: 2fm8 C:23-262

Lineage for d2fm8c1 (2fm8 C:23-262)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.257: SipA N-terminal domain-like [140745] (1 superfamily)
   multihelical; bundle; the last helix is buried inside the bundle

4. Superfamily a.257.1: SipA N-terminal domain-like [140746] (1 family)
   automatically mapped to Pfam PF09052

5. Family a.257.1.1: SipA N-terminal domain-like [140747] (1 protein)
   N-terminal part of Pfam PF09052

6. Protein Cell invasion protein SipA, N-terminal domain [140748] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [140749] (2 PDB entries)
   Uniprot Q56027 23-262! Uniprot Q56027 49-263

8. Domain d2fm8c1: 2fm8 C:23-262 [133769]
   Other proteins in same PDB: d2fm8a1, d2fm8b_

Details for d2fm8c1

PDB Entry: 2fm8, 2.2 Å

PDB Description: crystal structure of the salmonella secretion chaperone invb in complex with sipa

PDB Compounds: (C:) Cell invasion protein sipA

SCOPe Domain Sequences for d2fm8c1:

Sequence, based on SEQRES records:

>d2fm8c1 a.257.1.1 (C:23-262) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
qatnlaanlsavresatatlsgeikgpqledfpalikqasldalfkcgkdaealkevftn
snnvagkkaimefaglfrsalnatsdspeaktllmkvgaeytaqiikdglkeksafgpwl
petkkaeaklenlekqlldiiknntggelsklstnlvmqevmpyiasciehnfgctldpl
trsnlthlvdkaaakavealdmchqkltqeqgtsvgrearhlemqtliplllrnvfaqip

Sequence, based on observed residues (ATOM records):

>d2fm8c1 a.257.1.1 (C:23-262) Cell invasion protein SipA, N-terminal domain {Salmonella typhimurium [TaxId: 90371]}
qatnlaanlsavresatatlsgedfpalikqasldalfkcgkdaealkevftnsnnvagk
kaimefaglfrsalnatsdspeaktllmkvgaeytaqiikdglkeksafgpwlpetkkae
aklenlekqlldiiknnelsklstnlvmqevmpyiasciehnfgctldpltrsnlthlvd
kaaakavealdmchqklearhlemqtliplllrnvfaqip

Timeline for d2fm8c1:

• d2fm8c1 first appeared in SCOP 1.73
  
• d2fm8c1 appears in SCOPe 2.04
  
• d2fm8c1 appears in SCOPe 2.06
  
• d2fm8c1 appears in the current release, SCOPe 2.08