Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.198: Secretion chaperone-like [69634] (5 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families) |
Family d.198.1.0: automated matches [191351] (1 protein) not a true family |
Protein automated matches [190293] (3 species) not a true protein |
Species Salmonella typhimurium [TaxId:90371] [187098] (2 PDB entries) |
Domain d2fm8b2: 2fm8 B:1-134 [133768] Other proteins in same PDB: d2fm8a1, d2fm8b3, d2fm8c1 automated match to d1ry9a_ |
PDB Entry: 2fm8 (more details), 2.2 Å
SCOPe Domain Sequences for d2fm8b2:
Sequence, based on SEQRES records: (download)
>d2fm8b2 d.198.1.0 (B:1-134) automated matches {Salmonella typhimurium [TaxId: 90371]} mqhldiaelvrsalevsgcdpsliggidshstivldlfalpsicisvkdddvwiwaqlga dsmvvlqqrayeilmtimegchfarggqlllgeqngeltlkalvhpdflsdgekfstaln gfynylevfsrslm
>d2fm8b2 d.198.1.0 (B:1-134) automated matches {Salmonella typhimurium [TaxId: 90371]} mqhldiaelvrsalevsgcdstivldlfalpsicisvkdddvwiwaqlgadsmvvlqqra yeilmtimegchfarggqlllgeqngeltlkalvhpdflsdgekfstalngfynylevfs rslm
Timeline for d2fm8b2: