SCOPe 2.05: Domain d2fm8b_: 2fm8 B:

Lineage for d2fm8b_ (2fm8 B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
   alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta

4. Superfamily d.198.1: Type III secretory system chaperone-like [69635] (3 families)

5. Family d.198.1.0: automated matches [191351] (1 protein)
   not a true family

6. Protein automated matches [190293] (3 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:90371] [187098] (2 PDB entries)

8. Domain d2fm8b_: 2fm8 B: [133768]
   Other proteins in same PDB: d2fm8a1, d2fm8c1
   automated match to d1ry9a_

Details for d2fm8b_

PDB Entry: 2fm8, 2.2 Å

PDB Description: crystal structure of the salmonella secretion chaperone invb in complex with sipa

PDB Compounds: (B:) Surface presentation of antigens protein spaK

SCOPe Domain Sequences for d2fm8b_:

Sequence, based on SEQRES records:

>d2fm8b_ d.198.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mqhldiaelvrsalevsgcdpsliggidshstivldlfalpsicisvkdddvwiwaqlga
dsmvvlqqrayeilmtimegchfarggqlllgeqngeltlkalvhpdflsdgekfstaln
gfynylevfsrslmr

Sequence, based on observed residues (ATOM records):

>d2fm8b_ d.198.1.0 (B:) automated matches {Salmonella typhimurium [TaxId: 90371]}
mqhldiaelvrsalevsgcdstivldlfalpsicisvkdddvwiwaqlgadsmvvlqqra
yeilmtimegchfarggqlllgeqngeltlkalvhpdflsdgekfstalngfynylevfs
rslmr

Timeline for d2fm8b_:

• d2fm8b_ first appeared in SCOP 1.73, called d2fm8b1
  
• d2fm8b_ appears in SCOPe 2.04
  
• d2fm8b_ is called d2fm8b2 in SCOPe 2.06
  
• d2fm8b_ appears in the current release, SCOPe 2.08, called d2fm8b2