![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.198: Secretion chaperone-like [69634] (3 superfamilies) alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta |
![]() | Superfamily d.198.1: Type III secretory system chaperone [69635] (1 family) ![]() |
![]() | Family d.198.1.1: Type III secretory system chaperone [69636] (9 proteins) the family sequences are very divergent |
![]() | Protein Surface presentation of antigens protein SpaK (Spa15) [102748] (2 species) |
![]() | Species Salmonella typhimurium [TaxId:90371] [142901] (1 PDB entry) |
![]() | Domain d2fm8a1: 2fm8 A:1-134 [133767] Other proteins in same PDB: d2fm8c1 |
PDB Entry: 2fm8 (more details), 2.2 Å
SCOP Domain Sequences for d2fm8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fm8a1 d.198.1.1 (A:1-134) Surface presentation of antigens protein SpaK (Spa15) {Salmonella typhimurium [TaxId: 602]} mqhldiaelvrsalevsgcdpsliggidshstivldlfalpsicisvkdddvwiwaqlga dsmvvlqqrayeilmtimegchfarggqlllgeqngeltlkalvhpdflsdgekfstaln gfynylevfsrslm
Timeline for d2fm8a1: