Lineage for d2fm6a1 (2fm6 A:24-317)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 876590Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 876591Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (14 families) (S)
  5. 876592Family d.157.1.1: Zn metallo-beta-lactamase [56282] (1 protein)
  6. 876593Protein Zn metallo-beta-lactamase [56283] (10 species)
  7. 876661Species Xanthomonas maltophilia [TaxId:40324] [56286] (12 PDB entries)
  8. 876668Domain d2fm6a1: 2fm6 A:24-317 [133765]
    automatically matched to d1smla_
    complexed with gol, so4, zn

Details for d2fm6a1

PDB Entry: 2fm6 (more details), 1.75 Å

PDB Description: Zinc-beta-lactamase L1 from stenotrophomonas maltophilia (native form)
PDB Compounds: (A:) Metallo-beta-lactamase L1

SCOP Domain Sequences for d2fm6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm6a1 d.157.1.1 (A:24-317) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]}
evplpqlraytvdaswlqpmaplqiadhtwqigtedltallvqtpdgavlldggmpqmas
hlldnmkargvtprdlrlillshahadhagpvaelkrrtgakvaanaesavllarggsdd
lhfgdgityppanadrivmdgevitvggivftahfmaghtpgstawtwtdtrngkpvria
yadslsapgyqlqgnpryphliedyrrsfatvralpcdvlltphpgasnwdyaagaraga
kaltckayadaaeqkfdgqlaketag

SCOP Domain Coordinates for d2fm6a1:

Click to download the PDB-style file with coordinates for d2fm6a1.
(The format of our PDB-style files is described here.)

Timeline for d2fm6a1: