Lineage for d2fm4a1 (2fm4 A:384-509)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 823456Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 823457Superfamily c.8.1: Phosphohistidine domain [52009] (2 families) (S)
    contains barrel, closed, n=7, S=10
  5. 823458Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)
  6. 823459Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)
  7. 823460Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries)
  8. 823468Domain d2fm4a1: 2fm4 A:384-509 [133760]
    automatically matched to d1kbla2

Details for d2fm4a1

PDB Entry: 2fm4 (more details)

PDB Description: NMR structure of the phosphoryl carrier domain of pyruvate phosphate dikinase
PDB Compounds: (A:) Pyruvate, phosphate dikinase

SCOP Domain Sequences for d2fm4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm4a1 c.8.1.1 (A:384-509) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
aalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspediegmhaae
giltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyisldgstg
kiykgd

SCOP Domain Coordinates for d2fm4a1:

Click to download the PDB-style file with coordinates for d2fm4a1.
(The format of our PDB-style files is described here.)

Timeline for d2fm4a1: