SCOPe 2.08: Domain d2fm4a_: 2fm4 A:

Lineage for d2fm4a_ (2fm4 A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.1: Phosphohistidine domain [52009] (3 families)
   contains barrel, closed, n=7, S=10

5. Family c.8.1.1: Pyruvate phosphate dikinase, central domain [52010] (1 protein)

6. Protein Pyruvate phosphate dikinase, central domain [52011] (3 species)

7. Species Clostridium symbiosum [TaxId:1512] [52012] (8 PDB entries)

8. Domain d2fm4a_: 2fm4 A: [133760]
   automated match to d2fm4a1

Details for d2fm4a_

PDB Entry: 2fm4

PDB Description: nmr structure of the phosphoryl carrier domain of pyruvate phosphate dikinase

PDB Compounds: (A:) Pyruvate, phosphate dikinase

SCOPe Domain Sequences for d2fm4a_:

Sequence; same for both SEQRES and ATOM records:

>d2fm4a_ c.8.1.1 (A:) Pyruvate phosphate dikinase, central domain {Clostridium symbiosum [TaxId: 1512]}
aalkagevigsalpaspgaaagkvyftadeakaahekgervilvrletspediegmhaae
giltvrggmtshaavvargmgtccvsgcgeikineeaktfelgghtfaegdyisldgstg
kiykgdie

Timeline for d2fm4a_:

• d2fm4a_ first appeared in SCOP 1.73, called d2fm4a1
  
• d2fm4a_ appears in SCOPe 2.07