SCOP 1.75: Domain d2fm1c1: 2fm1 C:1-343

Lineage for d2fm1c1 (2fm1 C:1-343)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (9 families)

5. Family c.67.1.1: AAT-like [53384] (16 proteins)

6. Protein Low-specificity threonine aldolase [64123] (2 species)

7. Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)

8. Domain d2fm1c1: 2fm1 C:1-343 [133758]
   automatically matched to d1jg8d_
   complexed with ca, cl, gol, na

Details for d2fm1c1

PDB Entry: 2fm1, 2.25 Å

PDB Description: Crystal structure of L-ALLO-threonine aldolase (tm1744) from Thermotoga maritima at 2.25 A resolution

PDB Compounds: (C:) L-allo-threonine aldolase

SCOP Domain Sequences for d2fm1c1:

Sequence; same for both SEQRES and ATOM records:

>d2fm1c1 c.67.1.1 (C:1-343) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

Timeline for d2fm1c1:

• d2fm1c1 first appeared in SCOP 1.73
  
• d2fm1c1 is called d2fm1c_ in SCOPe 2.01
  
• d2fm1c1 appears in the current release, SCOPe 2.08, called d2fm1c_