Lineage for d2fm1a_ (2fm1 A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1176924Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1176925Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1176926Family c.67.1.1: AAT-like [53384] (17 proteins)
  6. 1177220Protein Low-specificity threonine aldolase [64123] (2 species)
  7. 1177224Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)
  8. 1177237Domain d2fm1a_: 2fm1 A: [133756]
    automated match to d1jg8a_
    complexed with ca, cl, gol, na

Details for d2fm1a_

PDB Entry: 2fm1 (more details), 2.25 Å

PDB Description: Crystal structure of L-ALLO-threonine aldolase (tm1744) from Thermotoga maritima at 2.25 A resolution
PDB Compounds: (A:) L-allo-threonine aldolase

SCOPe Domain Sequences for d2fm1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm1a_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

SCOPe Domain Coordinates for d2fm1a_:

Click to download the PDB-style file with coordinates for d2fm1a_.
(The format of our PDB-style files is described here.)

Timeline for d2fm1a_: