Lineage for d2fm1a1 (2fm1 A:1-343)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 705327Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 705328Superfamily c.67.1: PLP-dependent transferases [53383] (8 families) (S)
  5. 705329Family c.67.1.1: AAT-like [53384] (16 proteins)
  6. 705599Protein Low-specificity threonine aldolase [64123] (2 species)
  7. 705603Species Thermotoga maritima [TaxId:2336] [64124] (5 PDB entries)
  8. 705608Domain d2fm1a1: 2fm1 A:1-343 [133756]
    automatically matched to d1jg8d_
    complexed with ca, cl, gol, na

Details for d2fm1a1

PDB Entry: 2fm1 (more details), 2.25 Å

PDB Description: Crystal structure of L-ALLO-threonine aldolase (tm1744) from Thermotoga maritima at 2.25 A resolution
PDB Compounds: (A:) L-allo-threonine aldolase

SCOP Domain Sequences for d2fm1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm1a1 c.67.1.1 (A:1-343) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]}
midlrsdtvtkpteemrkamaqaevgddvygedptinelerlaaetfgkeaalfvpsgtm
gnqvsimahtqrgdevileadshifwyevgamavlsgvmphpvpgkngamdpddvrkair
prnihfprtsliaienthnrsggrvvplenikeictiakehginvhidgarifnasiasg
vpvkeyagyadsvmfclskglcapvgsvvvgdrdfierarkarkmlgggmrqagvlaaag
iialtkmvdrlkedhenarflalklkeigysvnpedvktnmvilrtdnlkvnahgfieal
rnsgvlanavsdteirlvthkdvsrndieealnifeklfrkfs

SCOP Domain Coordinates for d2fm1a1:

Click to download the PDB-style file with coordinates for d2fm1a1.
(The format of our PDB-style files is described here.)

Timeline for d2fm1a1: