Lineage for d2fm0d_ (2fm0 D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508381Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 1508441Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 1508442Species Human (Homo sapiens) [TaxId:9606] [89152] (35 PDB entries)
    Uniprot Q08499 388-713
  8. 1508484Domain d2fm0d_: 2fm0 D: [133755]
    automated match to d1f0ja_
    complexed with m98, mg, zn

Details for d2fm0d_

PDB Entry: 2fm0 (more details), 2 Å

PDB Description: Crystal structure of PDE4D in complex with L-869298
PDB Compounds: (D:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d2fm0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm0d_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
plwetwadlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d2fm0d_:

Click to download the PDB-style file with coordinates for d2fm0d_.
(The format of our PDB-style files is described here.)

Timeline for d2fm0d_: