Lineage for d2fm0d1 (2fm0 D:79-412)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651135Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 651136Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 651168Family a.211.1.2: PDEase [48548] (6 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. 651201Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. 651202Species Human (Homo sapiens) [TaxId:9606] [89152] (20 PDB entries)
  8. 651228Domain d2fm0d1: 2fm0 D:79-412 [133755]
    automatically matched to d1oyna_
    complexed with m98, mg, zn

Details for d2fm0d1

PDB Entry: 2fm0 (more details), 2 Å

PDB Description: Crystal structure of PDE4D in complex with L-869298
PDB Compounds: (D:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOP Domain Sequences for d2fm0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm0d1 a.211.1.2 (D:79-412) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
plwetwadlvhpdaqdildtlednrewyqstipq

SCOP Domain Coordinates for d2fm0d1:

Click to download the PDB-style file with coordinates for d2fm0d1.
(The format of our PDB-style files is described here.)

Timeline for d2fm0d1: