SCOP 1.75: Domain d2flwa1: 2flw A:2-129

Lineage for d2flwa1 (2flw A:2-129)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.1: CheY-like [52172] (7 families)

5. Family c.23.1.1: CheY-related [52173] (25 proteins)

6. Protein CheY protein [52174] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [52176] (13 PDB entries)

8. Domain d2flwa1: 2flw A:2-129 [133751]
   automatically matched to d2che__
   complexed with bef, mg, so4

Details for d2flwa1

PDB Entry: 2flw, 2 Å

PDB Description: Crystal structure of Mg2+ and BeF3- ound CheY in complex with CheZ 200-214 solved from a F432 crystal grown in Hepes (pH 7.5)

PDB Compounds: (A:) Chemotaxis protein cheY

SCOP Domain Sequences for d2flwa1:

Sequence; same for both SEQRES and ATOM records:

>d2flwa1 c.23.1.1 (A:2-129) CheY protein {Salmonella typhimurium [TaxId: 90371]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm

Timeline for d2flwa1:

• d2flwa1 first appeared in SCOP 1.73
  
• d2flwa1 is called d2flwa_ in SCOPe 2.01
  
• d2flwa1 appears in the current release, SCOPe 2.08, called d2flwa_