| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (7 families) ![]() |
| Family c.23.1.1: CheY-related [52173] (25 proteins) |
| Protein CheY protein [52174] (4 species) |
| Species Salmonella typhimurium [TaxId:90371] [52176] (11 PDB entries) |
| Domain d2flwa1: 2flw A:2-129 [133751] automatically matched to d2che__ complexed with bef, mg, so4 |
PDB Entry: 2flw (more details), 2 Å
SCOP Domain Sequences for d2flwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2flwa1 c.23.1.1 (A:2-129) CheY protein {Salmonella typhimurium [TaxId: 602]}
adkelkflvvddfstmrrivrnllkelgfnnveeaedgvdalnklqaggfgfiisdwnmp
nmdglellktiradsamsalpvlmvtaeakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
Timeline for d2flwa1: