Lineage for d2flux1 (2flu X:325-609)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807606Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2808612Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2808613Family b.68.11.1: Kelch motif [117282] (2 proteins)
    Pfam PF01344; sequence motif corresponding to one beta-sheet blade; similar sequences are found in the Galactose oxidase 7-bladed beta-propeller domain (50967)
  6. 2808614Protein Kelch-like ECH-associated protein 1, KEAP1 [117283] (2 species)
  7. 2808615Species Human (Homo sapiens) [TaxId:9606] [117284] (3 PDB entries)
    Uniprot Q14145 322-609
  8. 2808617Domain d2flux1: 2flu X:325-609 [133750]
    automatically matched to d1u6dx_

Details for d2flux1

PDB Entry: 2flu (more details), 1.5 Å

PDB Description: Crystal Structure of the Kelch-Neh2 Complex
PDB Compounds: (X:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d2flux1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flux1 b.68.11.1 (X:325-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]}
grliytaggyfrqslsyleaynpsdgtwlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcapmsvprnrigvgvidghiyavggshgcihhnsverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitamn
tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmkhrrsalgitvhqg
riyvlggydghtfldsvecydpdtdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d2flux1:

Click to download the PDB-style file with coordinates for d2flux1.
(The format of our PDB-style files is described here.)

Timeline for d2flux1: