SCOPe 2.08: Domain d2flrt1: 2flr T:6-106

Lineage for d2flrt1 (2flr T:6-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
   Uniprot P13726 33-242

8. Domain d2flrt1: 2flr T:6-106 [133748]
   Other proteins in same PDB: d2flrh_, d2flrl1, d2flrl2
   automated match to d1o5dt1
   complexed with 7nh

Details for d2flrt1

PDB Entry: 2flr, 2.35 Å

PDB Description: novel 5-azaindole factor viia inhibitors

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2flrt1:

Sequence; same for both SEQRES and ATOM records:

>d2flrt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d2flrt1:

• d2flrt1 first appeared in SCOP 1.73
  
• d2flrt1 appears in SCOPe 2.07