| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein) Pfam PF02541 |
| Protein Exopolyphosphatase Ppx [110631] (2 species) |
| Species Escherichia coli [TaxId:562] [142466] (2 PDB entries) |
| Domain d2floc3: 2flo C:136-312 [133741] Other proteins in same PDB: d2floa1, d2flob1, d2floc1, d2flod1 automatically matched to 1U6Z A:136-312 |
PDB Entry: 2flo (more details), 2.2 Å
SCOP Domain Sequences for d2floc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2floc3 c.55.1.8 (C:136-312) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]}
kgrklvidigggstelvigenfepilvesrrmgcvsfaqlyfpggvinkenfqrarmaaa
qkletltwqfriqgwnvamgasgtikaahevlmemgekdgiitperleklvkevlrhrnf
aslslpglseerktvfvpglailcgvfdalairelrlsdgalregvlyemegrfrhq
Timeline for d2floc3: