Lineage for d2flob2 (2flo B:12-135)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 835945Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 835946Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 836501Family c.55.1.8: Ppx/GppA phosphatase [110630] (1 protein)
    Pfam PF02541
  6. 836502Protein Exopolyphosphatase Ppx [110631] (2 species)
  7. 836514Species Escherichia coli [TaxId:562] [142466] (2 PDB entries)
    Uniprot P0AFL6 11-134! Uniprot P0AFL6 135-311
  8. 836521Domain d2flob2: 2flo B:12-135 [133737]
    Other proteins in same PDB: d2floa1, d2flob1, d2floc1, d2flod1
    automatically matched to 1U6Z A:12-135

Details for d2flob2

PDB Entry: 2flo (more details), 2.2 Å

PDB Description: crystal structure of exopolyphosphatase (ppx) from e. coli o157:h7
PDB Compounds: (B:) exopolyphosphatase

SCOP Domain Sequences for d2flob2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flob2 c.55.1.8 (B:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]}
efaavdlgsnsfhmviarvvdgamqiigrlkqrvhladglgpdnmlseeamtrglnclsl
faerlqgfspasvcivgthtlrqalnatdflkraekvipypieiisgneearlifmgveh
tqpe

SCOP Domain Coordinates for d2flob2:

Click to download the PDB-style file with coordinates for d2flob2.
(The format of our PDB-style files is described here.)

Timeline for d2flob2: