Lineage for d2flob1 (2flo B:313-506)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 651135Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 651136Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 651320Family a.211.1.5: Ppx associated domain [140773] (1 protein)
    this domain is C-terminal to Ppx domain in some Exopolyphosphatases
  6. 651321Protein Exopolyphosphatase Ppx C-terminal domain [140774] (1 species)
  7. 651322Species Escherichia coli [TaxId:562] [140775] (2 PDB entries)
  8. 651326Domain d2flob1: 2flo B:313-506 [133736]
    Other proteins in same PDB: d2floa2, d2floa3, d2flob2, d2flob3, d2floc2, d2floc3, d2flod2, d2flod3
    automatically matched to 1U6Z A:313-509

Details for d2flob1

PDB Entry: 2flo (more details), 2.2 Å

PDB Description: crystal structure of exopolyphosphatase (ppx) from e. coli o157:h7
PDB Compounds: (B:) exopolyphosphatase

SCOP Domain Sequences for d2flob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flob1 a.211.1.5 (B:313-506) Exopolyphosphatase Ppx C-terminal domain {Escherichia coli [TaxId: 562]}
dvrsrtasslanqyhidseqarrvldttmqmyeqwreqqpklahpqleallrwaamlhev
glninhsglhrhsayilqnsdlpgfnqeqqlmmatlvryhrkaiklddlprftlfkkkqf
lpliqllrlgvllnnqrqatttpptltlitddshwtlrfphdwfsqnalvlldlekeqey
wegvagwrlkieee

SCOP Domain Coordinates for d2flob1:

Click to download the PDB-style file with coordinates for d2flob1.
(The format of our PDB-style files is described here.)

Timeline for d2flob1: