Lineage for d2flna2 (2fln A:26-299)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3016464Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 3016465Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 3018090Family e.8.1.7: Lesion bypass DNA polymerase (Y-family), catalytic domain [100888] (5 proteins)
    contains a distinct 'fingers' domain possibly related to the C-terminal subdomain of hypothetical protein Ta1206 (1qw2)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3018168Protein DNA polymerase iota [111295] (1 species)
  7. 3018169Species Human (Homo sapiens) [TaxId:9606] [111296] (19 PDB entries)
    Uniprot Q9UNA4
  8. 3018185Domain d2flna2: 2fln A:26-299 [133732]
    Other proteins in same PDB: d2flna1
    protein/DNA complex

Details for d2flna2

PDB Entry: 2fln (more details), 2.5 Å

PDB Description: binary complex of catalytic core of human DNA polymerase iota with DNA (template A)
PDB Compounds: (A:) DNA polymerase iota

SCOPe Domain Sequences for d2flna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flna2 e.8.1.7 (A:26-299) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
ssrvivhvdldcfyaqvemisnpelkdkplgvqqkylvvtcnyearklgvkklmnvrdak
ekcpqlvlvngedltryremsykvtelleefspvverlgfdenfvdltemvekrlqqlqs
delsavtvsghvynnqsinlldvlhirllvgsqiaaemreamynqlgltgcagvasnkll
aklvsgvfkpnqqtvllpescqhlihslnhikeipgigyktakclealginsvrdlqtfs
pkilekelgisvaqriqklsfgednspvilsgpp

SCOPe Domain Coordinates for d2flna2:

Click to download the PDB-style file with coordinates for d2flna2.
(The format of our PDB-style files is described here.)

Timeline for d2flna2: