SCOPe 2.08: Domain d2flmb_: 2flm B:

Lineage for d2flmb_ (2flm B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (322 PDB entries)
   Uniprot P02766 31-143

8. Domain d2flmb_: 2flm B: [133730]
   automated match to d1eta1_
   complexed with 6ca

Details for d2flmb_

PDB Entry: 2flm, 1.65 Å

PDB Description: Human transthyretin (TTR) complexed with bivalant amyloid inhibitor (6 carbon linker)

PDB Compounds: (B:) Transthyretin

SCOPe Domain Sequences for d2flmb_:

Sequence, based on SEQRES records:

>d2flmb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

Sequence, based on observed residues (ATOM records):

>d2flmb_ b.3.4.1 (B:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandprrytiaallspysysttavvtn

Timeline for d2flmb_:

• d2flmb_ first appeared in SCOP 1.73, called d2flmb1
  
• d2flmb_ appears in SCOPe 2.07