Lineage for d2flla1 (2fll A:300-414)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740696Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
    beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology
  4. 740697Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family) (S)
  5. 740698Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)
  6. 740766Protein DNA polymerase iota [111015] (1 species)
  7. 740767Species Human (Homo sapiens) [TaxId:9606] [111016] (8 PDB entries)
  8. 740775Domain d2flla1: 2fll A:300-414 [133727]
    Other proteins in same PDB: d2flla2
    automatically matched to d1t3na1
    complexed with doc, mg, ttp

Details for d2flla1

PDB Entry: 2fll (more details), 2.6 Å

PDB Description: Ternary complex of human DNA polymerase iota with DNA and dTTP
PDB Compounds: (A:) DNA polymerase iota

SCOP Domain Sequences for d2flla1:

Sequence, based on SEQRES records: (download)

>d2flla1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records): (download)

>d2flla1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqvmtpmvdilmklfrnmtllsvcfcnlk

SCOP Domain Coordinates for d2flla1:

Click to download the PDB-style file with coordinates for d2flla1.
(The format of our PDB-style files is described here.)

Timeline for d2flla1: