SCOP 1.73: Domain d2flla1: 2fll A:300-414

Lineage for d2flla1 (2fll A:300-414)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (1 family)

5. Family d.240.1.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100880] (5 proteins)

6. Protein DNA polymerase iota [111015] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [111016] (8 PDB entries)

8. Domain d2flla1: 2fll A:300-414 [133727]
   Other proteins in same PDB: d2flla2
   automatically matched to d1t3na1
   complexed with doc, mg, ttp

Details for d2flla1

PDB Entry: 2fll, 2.6 Å

PDB Description: Ternary complex of human DNA polymerase iota with DNA and dTTP

PDB Compounds: (A:) DNA polymerase iota

SCOP Domain Sequences for d2flla1:

Sequence, based on SEQRES records:

>d2flla1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqklgtgnydvmtpmvdilmklfrnmvnvkmpfhltllsvcfcnlk

Sequence, based on observed residues (ATOM records):

>d2flla1 d.240.1.1 (A:300-414) DNA polymerase iota {Human (Homo sapiens) [TaxId: 9606]}
qsfseedsfkkcsseveaknkieellasllnrvcqdgrkphtvrliirryssekhygres
rqcpipshviqvmtpmvdilmklfrnmtllsvcfcnlk

Timeline for d2flla1:

• d2flla1 is new in SCOP 1.73
  
• d2flla1 appears in SCOP 1.75
  
• d2flla1 appears in the current release, SCOPe 2.08