Lineage for d2flil1 (2fli L:3-219)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 814383Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) (S)
  5. 814414Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)
  6. 814415Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)
  7. 814428Species Streptococcus pyogenes [TaxId:1314] [141745] (1 PDB entry)
    Uniprot Q9A1H8 3-219
  8. 814440Domain d2flil1: 2fli L:3-219 [133725]
    automatically matched to 2FLI A:3-219
    complexed with dx5, zn

Details for d2flil1

PDB Entry: 2fli (more details), 1.8 Å

PDB Description: The crystal structure of D-ribulose 5-phosphate 3-epimerase from Streptococus pyogenes complexed with D-xylitol 5-phosphate
PDB Compounds: (L:) ribulose-phosphate 3-epimerase

SCOP Domain Sequences for d2flil1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flil1 c.1.2.2 (L:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]}
tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
tiracyeaganvfvagsylfkasdlvsqvqtlrtaln

SCOP Domain Coordinates for d2flil1:

Click to download the PDB-style file with coordinates for d2flil1.
(The format of our PDB-style files is described here.)

Timeline for d2flil1: