Lineage for d2flil_ (2fli L:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827466Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2827467Protein automated matches [190292] (36 species)
    not a true protein
  7. 2827715Species Streptococcus pyogenes [TaxId:1314] [187097] (1 PDB entry)
  8. 2827726Domain d2flil_: 2fli L: [133725]
    Other proteins in same PDB: d2flia1
    automated match to d1rpxa_
    complexed with dx5, zn

Details for d2flil_

PDB Entry: 2fli (more details), 1.8 Å

PDB Description: The crystal structure of D-ribulose 5-phosphate 3-epimerase from Streptococus pyogenes complexed with D-xylitol 5-phosphate
PDB Compounds: (L:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d2flil_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flil_ c.1.2.0 (L:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
tiracyeaganvfvagsylfkasdlvsqvqtlrtalnv

SCOPe Domain Coordinates for d2flil_:

Click to download the PDB-style file with coordinates for d2flil_.
(The format of our PDB-style files is described here.)

Timeline for d2flil_: