Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) |
Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein) |
Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species) |
Species Streptococcus pyogenes [TaxId:1314] [141745] (1 PDB entry) |
Domain d2flij1: 2fli J:3-219 [133723] automatically matched to 2FLI A:3-219 complexed with dx5, zn |
PDB Entry: 2fli (more details), 1.8 Å
SCOP Domain Sequences for d2flij1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2flij1 c.1.2.2 (J:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]} tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk tiracyeaganvfvagsylfkasdlvsqvqtlrtaln
Timeline for d2flij1: