Lineage for d2flig_ (2fli G:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2090271Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2091023Family c.1.2.0: automated matches [191350] (1 protein)
    not a true family
  6. 2091024Protein automated matches [190292] (34 species)
    not a true protein
  7. 2091254Species Streptococcus pyogenes [TaxId:1314] [187097] (1 PDB entry)
  8. 2091260Domain d2flig_: 2fli G: [133720]
    Other proteins in same PDB: d2flia1
    automated match to d1rpxa_
    complexed with dx5, zn

Details for d2flig_

PDB Entry: 2fli (more details), 1.8 Å

PDB Description: The crystal structure of D-ribulose 5-phosphate 3-epimerase from Streptococus pyogenes complexed with D-xylitol 5-phosphate
PDB Compounds: (G:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d2flig_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flig_ c.1.2.0 (G:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
stlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhsk
lvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtp
ataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdn
ktiracyeaganvfvagsylfkasdlvsqvqtlrtaln

SCOPe Domain Coordinates for d2flig_:

Click to download the PDB-style file with coordinates for d2flig_.
(The format of our PDB-style files is described here.)

Timeline for d2flig_: