![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) ![]() |
![]() | Family c.1.2.0: automated matches [191350] (1 protein) not a true family |
![]() | Protein automated matches [190292] (36 species) not a true protein |
![]() | Species Streptococcus pyogenes [TaxId:1314] [187097] (1 PDB entry) |
![]() | Domain d2flid_: 2fli D: [133717] Other proteins in same PDB: d2flia1 automated match to d1rpxa_ complexed with dx5, zn |
PDB Entry: 2fli (more details), 1.8 Å
SCOPe Domain Sequences for d2flid_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2flid_ c.1.2.0 (D:) automated matches {Streptococcus pyogenes [TaxId: 1314]} stlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhsk lvfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtp ataleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdn ktiracyeaganvfvagsylfkasdlvsqvqtlrtal
Timeline for d2flid_: