SCOP 1.75: Domain d2flic1: 2fli C:3-219

Lineage for d2flic1 (2fli C:3-219)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (1 protein)

6. Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)

7. Species Streptococcus pyogenes [TaxId:1314] [141745] (1 PDB entry)
   Uniprot Q9A1H8 3-219

8. Domain d2flic1: 2fli C:3-219 [133716]
   automatically matched to 2FLI A:3-219
   complexed with dx5, zn

Details for d2flic1

PDB Entry: 2fli, 1.8 Å

PDB Description: The crystal structure of D-ribulose 5-phosphate 3-epimerase from Streptococus pyogenes complexed with D-xylitol 5-phosphate

PDB Compounds: (C:) ribulose-phosphate 3-epimerase

SCOP Domain Sequences for d2flic1:

Sequence; same for both SEQRES and ATOM records:

>d2flic1 c.1.2.2 (C:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]}
tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
tiracyeaganvfvagsylfkasdlvsqvqtlrtaln

Timeline for d2flic1:

• d2flic1 first appeared in SCOP 1.73
  
• d2flic1 is called d2flic_ in SCOPe 2.01
  
• d2flic1 appears in the current release, SCOPe 2.08, called d2flic_