Lineage for d2flia1 (2fli A:3-219)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2826748Family c.1.2.2: D-ribulose-5-phosphate 3-epimerase [51372] (2 proteins)
    automatically mapped to Pfam PF00834
  6. 2826749Protein D-ribulose-5-phosphate 3-epimerase [51373] (5 species)
  7. 2826762Species Streptococcus pyogenes [TaxId:1314] [141745] (1 PDB entry)
    Uniprot Q9A1H8 3-219
  8. 2826763Domain d2flia1: 2fli A:3-219 [133714]
    Other proteins in same PDB: d2flib_, d2flic_, d2flid_, d2flie_, d2flif_, d2flig_, d2flih_, d2flii_, d2flij_, d2flik_, d2flil_
    complexed with dx5, zn

Details for d2flia1

PDB Entry: 2fli (more details), 1.8 Å

PDB Description: The crystal structure of D-ribulose 5-phosphate 3-epimerase from Streptococus pyogenes complexed with D-xylitol 5-phosphate
PDB Compounds: (A:) ribulose-phosphate 3-epimerase

SCOPe Domain Sequences for d2flia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flia1 c.1.2.2 (A:3-219) D-ribulose-5-phosphate 3-epimerase {Streptococcus pyogenes [TaxId: 1314]}
tlkiapsilaadyanfaselarieetdaeyvhidimdgqfvpnisfgadvvasmrkhskl
vfdchlmvvdperyveafaqagadimtihtestrhihgalqkikaagmkagvvinpgtpa
taleplldlvdqvlimtvnpgfggqafipeclekvatvakwrdekglsfdievdggvdnk
tiracyeaganvfvagsylfkasdlvsqvqtlrtaln

SCOPe Domain Coordinates for d2flia1:

Click to download the PDB-style file with coordinates for d2flia1.
(The format of our PDB-style files is described here.)

Timeline for d2flia1: