Lineage for d2flbt2 (2flb T:109-205)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 657193Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 657194Family b.1.2.1: Fibronectin type III [49266] (43 protein domains)
    Pfam PF00041
  6. 657284Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 657310Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)
  8. 657322Domain d2flbt2: 2flb T:109-205 [133712]
    Other proteins in same PDB: d2flbh1
    automatically matched to d1a21a2
    complexed with 6nh

Details for d2flbt2

PDB Entry: 2flb (more details), 1.95 Å

PDB Description: discovery of a novel hydroxy pyrazole based factor ixa inhibitor
PDB Compounds: (T:) tissue factor

SCOP Domain Sequences for d2flbt2:

Sequence, based on SEQRES records: (download)

>d2flbt2 b.1.2.1 (T:109-205) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkkta
ktntneflidvdkgenycfsvqavipsrtvnrkstds

Sequence, based on observed residues (ATOM records): (download)

>d2flbt2 b.1.2.1 (T:109-205) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gdertlvrrnntflslrdvfgkdliytlyysvqavipsrtvnrkstds

SCOP Domain Coordinates for d2flbt2:

Click to download the PDB-style file with coordinates for d2flbt2.
(The format of our PDB-style files is described here.)

Timeline for d2flbt2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2flbt1
View in 3D
Domains from other chains:
(mouse over for more information)
d2flbh1