![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
![]() | Family b.1.2.1: Fibronectin type III [49266] (45 proteins) Pfam PF00041 |
![]() | Protein Extracellular region of human tissue factor [49267] (2 species) tandem of fibronectin type III domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries) Uniprot P13726 33-242 |
![]() | Domain d2flbt2: 2flb T:107-205 [133712] Other proteins in same PDB: d2flbh_, d2flbl1, d2flbl2 automated match to d1o5dt2 complexed with 6nh fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 2flb (more details), 1.95 Å
SCOPe Domain Sequences for d2flbt2:
Sequence, based on SEQRES records: (download)
>d2flbt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgqptiqsfeqvgtkvnvtvedertlvrrnntflslrdvfgkdliytlyywkssssgkk taktntneflidvdkgenycfsvqavipsrtvnrkstds
>d2flbt2 b.1.2.1 (T:107-205) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} nlgdertlvrrnntflslrdvfgkdliytlyysvqavipsrtvnrkstds
Timeline for d2flbt2: