SCOPe 2.04: Domain d2flbt1: 2flb T:6-106

Lineage for d2flbt1 (2flb T:6-106)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Extracellular region of human tissue factor [49267] (2 species)
   tandem of fibronectin type III domains

7. Species Human (Homo sapiens) [TaxId:9606] [49268] (32 PDB entries)
   Uniprot P13726 33-242

8. Domain d2flbt1: 2flb T:6-106 [133711]
   Other proteins in same PDB: d2flbh_, d2flbl1, d2flbl2
   automated match to d1o5dt1
   complexed with 6nh

Details for d2flbt1

PDB Entry: 2flb, 1.95 Å

PDB Description: discovery of a novel hydroxy pyrazole based factor ixa inhibitor

PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2flbt1:

Sequence; same for both SEQRES and ATOM records:

>d2flbt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

Timeline for d2flbt1:

• d2flbt1 first appeared in SCOP 1.73
  
• d2flbt1 appears in SCOPe 2.03
  
• d2flbt1 appears in SCOPe 2.05
  
• d2flbt1 appears in the current release, SCOPe 2.08