Lineage for d2flbt1 (2flb T:6-108)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 935729Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 935730Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 935829Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. 935858Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [49269] (18 PDB entries)
  8. 935869Domain d2flbt1: 2flb T:6-108 [133711]
    Other proteins in same PDB: d2flbh_
    automatically matched to d1a21a1
    complexed with 6nh

Details for d2flbt1

PDB Entry: 2flb (more details), 1.95 Å

PDB Description: discovery of a novel hydroxy pyrazole based factor ixa inhibitor
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2flbt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flbt1 b.1.2.1 (T:6-108) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpyletnl

SCOPe Domain Coordinates for d2flbt1:

Click to download the PDB-style file with coordinates for d2flbt1.
(The format of our PDB-style files is described here.)

Timeline for d2flbt1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2flbt2
View in 3D
Domains from other chains:
(mouse over for more information)
d2flbh_