Lineage for d2flbt1 (2flb T:6-106)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. Protein Extracellular region of human tissue factor [49267] (2 species)
    tandem of fibronectin type III domains
  7. Species Human (Homo sapiens) [TaxId:9606] [49268] (35 PDB entries)
    Uniprot P13726 33-242
  8. Domain d2flbt1: 2flb T:6-106 [133711]
    Other proteins in same PDB: d2flbh_, d2flbl1, d2flbl2
    automated match to d1o5dt1
    complexed with 6nh

Details for d2flbt1

PDB Entry: 2flb (more details), 1.95 Å

PDB Description: discovery of a novel hydroxy pyrazole based factor ixa inhibitor
PDB Compounds: (T:) tissue factor

SCOPe Domain Sequences for d2flbt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flbt1 b.1.2.1 (T:6-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]}
tvaaynltwkstnfktilewepkpvnqvytvqistksgdwkskcfyttdtecdltdeivk
dvkqtylarvfsypagnvestgsageplyenspeftpylet

SCOPe Domain Coordinates for d2flbt1 are not available.

Timeline for d2flbt1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2flbt2
View in 3D
Domains from other chains:
(mouse over for more information)
d2flbh_, d2flbl1, d2flbl2