Lineage for d2flaa_ (2fla A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261760Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
    folds around 4Fe-4S cluster
  4. 2261761Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) (S)
  5. 2261762Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)
  6. 2261763Protein HIPIP (high potential iron protein) [57654] (9 species)
  7. 2261799Species Thermochromatium tepidum [TaxId:1050] [57660] (8 PDB entries)
  8. 2261804Domain d2flaa_: 2fla A: [133709]
    automated match to d1eyta_
    complexed with gol, sf4, so4

Details for d2flaa_

PDB Entry: 2fla (more details), 0.95 Å

PDB Description: structure of thereduced hipip from thermochromatium tepidum at 0.95 angstrom resolution
PDB Compounds: (A:) high-potential iron-sulfur protein

SCOPe Domain Sequences for d2flaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2flaa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

SCOPe Domain Coordinates for d2flaa_:

Click to download the PDB-style file with coordinates for d2flaa_.
(The format of our PDB-style files is described here.)

Timeline for d2flaa_: