SCOP 1.73: Domain d2flaa1: 2fla A:1-83

Lineage for d2flaa1 (2fla A:1-83)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (7 species)

7. Species Thermochromatium tepidum [TaxId:1050] [57660] (4 PDB entries)

8. Domain d2flaa1: 2fla A:1-83 [133709]
   automatically matched to d1eyta_
   complexed with gol, sf4, so4

Details for d2flaa1

PDB Entry: 2fla, 0.95 Å

PDB Description: structure of thereduced hipip from thermochromatium tepidum at 0.95 angstrom resolution

PDB Compounds: (A:) high-potential iron-sulfur protein

SCOP Domain Sequences for d2flaa1:

Sequence; same for both SEQRES and ATOM records:

>d2flaa1 g.35.1.1 (A:1-83) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

Timeline for d2flaa1:

• d2flaa1 is new in SCOP 1.73
  
• d2flaa1 appears in SCOP 1.75
  
• d2flaa1 appears in the current release, SCOPe 2.08, called d2flaa_