SCOPe 2.08: Domain d2flaa_: 2fla A:

Lineage for d2flaa_ (2fla A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily)
   folds around 4Fe-4S cluster

4. Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family)

5. Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein)

6. Protein HIPIP (high potential iron protein) [57654] (9 species)

7. Species Thermochromatium tepidum [TaxId:1050] [57660] (11 PDB entries)

8. Domain d2flaa_: 2fla A: [133709]
   automated match to d1eyta_
   complexed with gol, sf4, so4

Details for d2flaa_

PDB Entry: 2fla, 0.95 Å

PDB Description: structure of thereduced hipip from thermochromatium tepidum at 0.95 angstrom resolution

PDB Compounds: (A:) high-potential iron-sulfur protein

SCOPe Domain Sequences for d2flaa_:

Sequence; same for both SEQRES and ATOM records:

>d2flaa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]}
aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg
cqlfpgklinvngwcaswtlkag

Timeline for d2flaa_:

• d2flaa_ first appeared in SCOP 1.73, called d2flaa1
  
• d2flaa_ appears in SCOPe 2.07