Lineage for d2fl4a1 (2fl4 A:1-146)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209198Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2209465Protein Probable spermine/spermidine acetyltransferase EF1086 [143682] (1 species)
  7. 2209466Species Enterococcus faecalis [TaxId:1351] [143683] (1 PDB entry)
    Uniprot Q836M4 1-146
  8. 2209467Domain d2fl4a1: 2fl4 A:1-146 [133706]
    Other proteins in same PDB: d2fl4a2

Details for d2fl4a1

PDB Entry: 2fl4 (more details), 1.6 Å

PDB Description: The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
PDB Compounds: (A:) spermine/spermidine acetyltransferase

SCOPe Domain Sequences for d2fl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]}
meihfekvtsdnrkavenlqvfaeqqafiesmaenlkesdqfpewesagiydgnqligya
mygrwqdgrvwldrflidqrfqgqgygkaacrllmlkliekyqtnklylsvydtnssair
lyqqlgfvfngeldtngervmewthq

SCOPe Domain Coordinates for d2fl4a1:

Click to download the PDB-style file with coordinates for d2fl4a1.
(The format of our PDB-style files is described here.)

Timeline for d2fl4a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fl4a2