Lineage for d2fl4a1 (2fl4 A:1-146)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731256Protein Probable spermine/spermidine acetyltransferase EF1086 [143682] (1 species)
  7. 731257Species Enterococcus faecalis [TaxId:1351] [143683] (1 PDB entry)
  8. 731258Domain d2fl4a1: 2fl4 A:1-146 [133706]

Details for d2fl4a1

PDB Entry: 2fl4 (more details), 1.6 Å

PDB Description: The crystal structure of the spermine/spermidine acetyltransferase from Enterococcus faecalis
PDB Compounds: (A:) spermine/spermidine acetyltransferase

SCOP Domain Sequences for d2fl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]}
meihfekvtsdnrkavenlqvfaeqqafiesmaenlkesdqfpewesagiydgnqligya
mygrwqdgrvwldrflidqrfqgqgygkaacrllmlkliekyqtnklylsvydtnssair
lyqqlgfvfngeldtngervmewthq

SCOP Domain Coordinates for d2fl4a1:

Click to download the PDB-style file with coordinates for d2fl4a1.
(The format of our PDB-style files is described here.)

Timeline for d2fl4a1: