Lineage for d2fl2b_ (2fl2 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111709Protein automated matches [190129] (6 species)
    not a true protein
  7. 2111718Species Human (Homo sapiens) [TaxId:9606] [187145] (33 PDB entries)
  8. 2111775Domain d2fl2b_: 2fl2 B: [133705]
    automated match to d1q0bb_
    complexed with adp, mg, n4t

Details for d2fl2b_

PDB Entry: 2fl2 (more details), 2.5 Å

PDB Description: crystal structure of KSP in complex with inhibitor 19
PDB Compounds: (B:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d2fl2b_:

Sequence, based on SEQRES records: (download)

>d2fl2b_ c.37.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyresklt
rilqdslggrtrtsiiatispaslnleetlstleyahraknilnk

Sequence, based on observed residues (ATOM records): (download)

>d2fl2b_ c.37.1.9 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgastk
qidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiip
rtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgviik
gleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelvk
igklnlvdlagsenninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsi
iatispaslnleetlstleyahraknilnk

SCOPe Domain Coordinates for d2fl2b_:

Click to download the PDB-style file with coordinates for d2fl2b_.
(The format of our PDB-style files is described here.)

Timeline for d2fl2b_: