Lineage for d2fl0g_ (2fl0 G:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 910727Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 911451Protein automated matches [190041] (18 species)
    not a true protein
  7. 911477Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries)
  8. 911499Domain d2fl0g_: 2fl0 G: [133702]
    automated match to d1bcfa_
    complexed with fe2, hem, mg

Details for d2fl0g_

PDB Entry: 2fl0 (more details), 2.7 Å

PDB Description: Oxidized (All ferric) form of the Azotobacter vinelandii bacterioferritin
PDB Compounds: (G:) bacterioferritin

SCOPe Domain Sequences for d2fl0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fl0g_ a.25.1.1 (G:) automated matches {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqmd

SCOPe Domain Coordinates for d2fl0g_:

Click to download the PDB-style file with coordinates for d2fl0g_.
(The format of our PDB-style files is described here.)

Timeline for d2fl0g_: