Lineage for d2fl0f1 (2fl0 F:1-154)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 638520Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 638604Protein Bacterioferritin (cytochrome b1) [47244] (4 species)
    binds heme between two subunits; 24-mer
  7. 638605Species Azotobacter vinelandii [TaxId:354] [140431] (3 PDB entries)
  8. 638627Domain d2fl0f1: 2fl0 F:1-154 [133701]
    automatically matched to 1SOF A:1-154
    complexed with fe2, hem, mg

Details for d2fl0f1

PDB Entry: 2fl0 (more details), 2.7 Å

PDB Description: Oxidized (All ferric) form of the Azotobacter vinelandii bacterioferritin
PDB Compounds: (F:) bacterioferritin

SCOP Domain Sequences for d2fl0f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fl0f1 a.25.1.1 (F:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqm

SCOP Domain Coordinates for d2fl0f1:

Click to download the PDB-style file with coordinates for d2fl0f1.
(The format of our PDB-style files is described here.)

Timeline for d2fl0f1: