Lineage for d2fkzd_ (2fkz D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1989404Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1990371Protein automated matches [190041] (27 species)
    not a true protein
  7. 1990397Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries)
  8. 1990401Domain d2fkzd_: 2fkz D: [133691]
    automated match to d1bcfa_
    complexed with fe2, hem, mg

Details for d2fkzd_

PDB Entry: 2fkz (more details), 2 Å

PDB Description: Reduced (All Ferrous) form of the Azotobacter vinelandii bacterioferritin
PDB Compounds: (D:) bacterioferritin

SCOPe Domain Sequences for d2fkzd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkzd_ a.25.1.1 (D:) automated matches {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqmd

SCOPe Domain Coordinates for d2fkzd_:

Click to download the PDB-style file with coordinates for d2fkzd_.
(The format of our PDB-style files is described here.)

Timeline for d2fkzd_: