Lineage for d2fkzc_ (2fkz C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2702255Protein automated matches [190041] (34 species)
    not a true protein
  7. 2702281Species Azotobacter vinelandii [TaxId:354] [186762] (3 PDB entries)
  8. 2702284Domain d2fkzc_: 2fkz C: [133690]
    automated match to d1bcfa_
    complexed with fe2, hem, mg

Details for d2fkzc_

PDB Entry: 2fkz (more details), 2 Å

PDB Description: Reduced (All Ferrous) form of the Azotobacter vinelandii bacterioferritin
PDB Compounds: (C:) bacterioferritin

SCOPe Domain Sequences for d2fkzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkzc_ a.25.1.1 (C:) automated matches {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqmd

SCOPe Domain Coordinates for d2fkzc_:

Click to download the PDB-style file with coordinates for d2fkzc_.
(The format of our PDB-style files is described here.)

Timeline for d2fkzc_: