Lineage for d2fkza1 (2fkz A:1-154)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 766018Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 766019Superfamily a.25.1: Ferritin-like [47240] (9 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 766020Family a.25.1.1: Ferritin [47241] (9 proteins)
  6. 766114Protein Bacterioferritin (cytochrome b1) [47244] (4 species)
    binds heme between two subunits; 24-mer
  7. 766115Species Azotobacter vinelandii [TaxId:354] [140431] (3 PDB entries)
    Uniprot P22759 1-155
  8. 766116Domain d2fkza1: 2fkz A:1-154 [133688]
    automatically matched to 1SOF A:1-154
    complexed with fe2, hem, mg

Details for d2fkza1

PDB Entry: 2fkz (more details), 2 Å

PDB Description: Reduced (All Ferrous) form of the Azotobacter vinelandii bacterioferritin
PDB Compounds: (A:) bacterioferritin

SCOP Domain Sequences for d2fkza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkza1 a.25.1.1 (A:1-154) Bacterioferritin (cytochrome b1) {Azotobacter vinelandii [TaxId: 354]}
mkgdkiviqhlnkilgneliainqyflharmyedwgleklgkheyhesidemkhadklik
rilfleglpnlqelgklligehtkemlecdlkleqaglpdlkaaiaycesvgdyasrell
edileseedhidwletqldlidkiglenylqsqm

SCOP Domain Coordinates for d2fkza1:

Click to download the PDB-style file with coordinates for d2fkza1.
(The format of our PDB-style files is described here.)

Timeline for d2fkza1: