Lineage for d2fkpa2 (2fkp A:6-132)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860453Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 860454Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 860455Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 860639Protein N-acylamino acid racemase [110937] (4 species)
  7. 860657Species Deinococcus radiodurans [TaxId:1299] [110939] (4 PDB entries)
    Uniprot Q9RYA6
  8. 860662Domain d2fkpa2: 2fkp A:6-132 [133666]
    Other proteins in same PDB: d2fkpa1
    mutant

Details for d2fkpa2

PDB Entry: 2fkp (more details), 2 Å

PDB Description: The mutant G127C-T313C of Deinococcus Radiodurans N-acylamino acid racemase
PDB Compounds: (A:) N-acylamino acid racemase

SCOP Domain Sequences for d2fkpa2:

Sequence, based on SEQRES records: (download)

>d2fkpa2 d.54.1.1 (A:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lctllgg

Sequence, based on observed residues (ATOM records): (download)

>d2fkpa2 d.54.1.1 (A:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplctllgg

SCOP Domain Coordinates for d2fkpa2:

Click to download the PDB-style file with coordinates for d2fkpa2.
(The format of our PDB-style files is described here.)

Timeline for d2fkpa2: