Lineage for d2fkpa1 (2fkp A:133-375)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 973407Superfamily c.1.11: Enolase C-terminal domain-like [51604] (2 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 973472Family c.1.11.2: D-glucarate dehydratase-like [51609] (13 proteins)
  6. 973591Protein N-acylamino acid racemase [110372] (4 species)
  7. 973609Species Deinococcus radiodurans [TaxId:1299] [110374] (4 PDB entries)
    Uniprot Q9RYA6
  8. 973614Domain d2fkpa1: 2fkp A:133-375 [133665]
    Other proteins in same PDB: d2fkpa2
    mutant

Details for d2fkpa1

PDB Entry: 2fkp (more details), 2 Å

PDB Description: the mutant g127c-t313c of deinococcus radiodurans n-acylamino acid racemase
PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d2fkpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkpa1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
hkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirl
tvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasas
darkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihls
clsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqee
hra

SCOPe Domain Coordinates for d2fkpa1:

Click to download the PDB-style file with coordinates for d2fkpa1.
(The format of our PDB-style files is described here.)

Timeline for d2fkpa1: