![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (4 proteins) archaeal hexapeptide repeat proteins this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain |
![]() | Protein Ferripyochelin binding protein [101965] (1 species) |
![]() | Species Pyrococcus horikoshii [TaxId:53953] [101966] (3 PDB entries) |
![]() | Domain d2fkoa_: 2fko A: [133664] automated match to d1v3wa_ complexed with edo, zn |
PDB Entry: 2fko (more details), 1.85 Å
SCOPe Domain Sequences for d2fkoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fkoa_ b.81.1.5 (A:) Ferripyochelin binding protein {Pyrococcus horikoshii [TaxId: 53953]} maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri
Timeline for d2fkoa_: