Lineage for d2fkoa1 (2fko A:1-173)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 677067Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 677068Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (7 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 677197Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (3 proteins)
    archaeal hexapeptide repeat proteins
    this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain
  6. 677198Protein Ferripyochelin binding protein [101965] (1 species)
  7. 677199Species Archaeon Pyrococcus horikoshii [TaxId:53953] [101966] (3 PDB entries)
  8. 677201Domain d2fkoa1: 2fko A:1-173 [133664]
    automatically matched to d1v3wa_
    complexed with edo, zn

Details for d2fkoa1

PDB Entry: 2fko (more details), 1.85 Å

PDB Description: Structure of PH1591 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) 173aa long hypothetical ferripyochelin binding protein

SCOP Domain Sequences for d2fkoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fkoa1 b.81.1.5 (A:1-173) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd
nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav
vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri

SCOP Domain Coordinates for d2fkoa1:

Click to download the PDB-style file with coordinates for d2fkoa1.
(The format of our PDB-style files is described here.)

Timeline for d2fkoa1: