SCOP 1.73: Domain d2fkoa1: 2fko A:1-173

Lineage for d2fkoa1 (2fko A:1-173)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (3 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (7 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.5: gamma-carbonic anhydrase-like [51174] (3 proteins)
   archaeal hexapeptide repeat proteins
   this is a repeat family; one repeat unit is 1v3w A:71-88 found in domain

6. Protein Ferripyochelin binding protein [101965] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [101966] (3 PDB entries)

8. Domain d2fkoa1: 2fko A:1-173 [133664]
   automatically matched to d1v3wa_
   complexed with edo, zn

Details for d2fkoa1

PDB Entry: 2fko, 1.85 Å

PDB Description: Structure of PH1591 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) 173aa long hypothetical ferripyochelin binding protein

SCOP Domain Sequences for d2fkoa1:

Sequence; same for both SEQRES and ATOM records:

>d2fkoa1 b.81.1.5 (A:1-173) Ferripyochelin binding protein {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
maiyeingkkprihpsafvdenavvigdvvleektsvwpsavlrgdieqiyvgkysnvqd
nvsihtshgypteigeyvtighnamvhgakvgnyviigissvildgakigdhviigagav
vppnkeipdyslvlgvpgkvvrqlteeeiewtkknaeiyvelaekhikgrkri

Timeline for d2fkoa1:

• d2fkoa1 is new in SCOP 1.73
  
• d2fkoa1 appears in SCOP 1.75
  
• d2fkoa1 appears in the current release, SCOPe 2.08, called d2fkoa_